Terrell Owens

TerrellOwens

  • Receptor Abierto
FDN
Universidad
Info Draft
7/12/1973
Anderson (SC)
1996: Rd 3, Sel. 89 (SF)
Career Stats
REC
1078
RECYDS
15,934
TD
153
AVG
14.8

Estadísticas

Recibiendo
temporadaEquipo
1996
1997
1998
1999
2000
2001
2002
2003
2004
2005
2006
2007
2008
2009
2010
Carrera
JRECTGTRECYDSAVGTDLARGOFIRSTFCMP
1635052014.94462311
1660093615.68564810
166701,09716.414795211
1460075412.64363611
149701,45115.013696521
169301,41215.216607000
1410001,30013.013766100
158001,10213.89755500
147701,20015.614595121
747076316.26913200
16851531,18013.913566200
15811441,35516.715526900
16691401,05215.210753811
165510982915.15983310
147213998313.79784700
219107868515,93414.815398742106
Corriendo
temporadaEquipo
1998
2000
2001
2002
2003
2004
2005
2007
2008
2009
Carrera
JATTRYDSYDS/RATDLARGOFIRSTFFL
1645313.3121300
143113.705011
164215.3012100
1477911.3138300
153-2-0.703000
143-5-1.706000
7122.002000
15155.005000
167334.708200
166549.0129200
219392516.43381111
Returning
temporadaEquipo
1996
1997
Carrera
puntskickoffs
JPRPRYDSTDFCLNGKRYDSTDKRFCLNG
16000003470018
16000002310023
219000005780023
Defensiva
temporadaEquipo
1998
2001
2003
2004
2005
2006
2007
2008
2009
2010
Carrera
JTOTSOLOASTCAPT.FFFRFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
160000110000.0000000
164310100000.0000000
152200000000.0000000
141100000000.0000000
72200000000.0000000
163300000000.0000000
153300000000.0001000
163300000000.0000000
162200000000.0000000
144400000000.0000000
219242310210000.0001000
Puntos
temporadaEquipo
1996
1997
1998
1999
2000
2001
2002
2003
2004
2005
2006
2007
2008
2009
2010
Carrera
JTDRUSTDRECTDRETTDTTD2PTXPFGTP
160040400024
160080800048
16011401510092
140040400024
14001301310080
16001601600096
14011301400084
150090900054
14001401400084
70060600036
16001301310080
15001501500090
16001001000060
160150600036
140090900054
219031530156300942
Datos provistos por Elias Sports Bureau

Glosario

  • 1-19:FGM 1-19 yardas
  • 20-29:FGM 20-29 yardas
  • 2PT:Total de conversiones por dos puntos
  • 30-39:FGM 30-39 yardas
  • 40-49:FGM 40-49 yardas
  • 50+:FGM 50+ yardas
  • AST:Tacleadas de Asistencia.
  • ATT:Acarreos
  • AVG:Yardas por recepción
  • CAPT.:Capturas de Mariscal
  • CMP:Balones sueltos perdidos despues de la recepcion
  • CMP%:Porcentaje de completos
  • Despejes:Despejes
  • F:Balones soltados después de la recepción
  • FC:Recepciones libres en devolución de despeje
  • FF:Balones sueltos forzados
  • FG:Goles de campo
  • FIRST:Primeras oportunidades por recepciones
  • FL:Balones sueltos por acarreo perdidos
  • FR:Balones sueltos recuperados
  • FRYDS:Yardas por balones sueltos recuperados
  • INT:Intercepciones
  • INT.:Intentos de pase
  • J:Partidos jugados
  • KB:Patadas bloqueadas
  • KR:Devoluciones de patada
  • KRFC:Recepciones libres en patadas de salida
  • LARGO:Recepción más larga
  • LNG:Devolución de despeje más larga
  • Más largo:Despeje más largo
  • NYDS/P:Promedio neto de yardas por despeje
  • P 10%:Porcentaje de despejes dentro de la yarda 20
  • P 20:Despejes dentro de la 20
  • PD:Pases defendidos
  • PR:Devoluciones de despeje
  • PRYDS:Yardas en devoluciones de despeje
  • PTS:Total de puntos en despejes
  • PYDS:Yardas en despejes
  • QBR:QBR Ajustado
  • REC:Recepciones
  • RECTD:Touchdown por recepción
  • RECYDS:Yardas Recibiendo
  • RETTD:Touchdown por retornos
  • RTG:Indice de Pasador
  • RUSTD:Touchdowns por acarreo
  • RYDS:Yardas por Tierra
  • SOLO:Tacleadas solo
  • STF:Jugadas con pérdida de yardas
  • STFYDS:Yardas corrida negativa
  • TB:Touchbacks
  • TB%:Porcentaje de Touchback
  • TC%:Porcentaje de goles de campo
  • TD:Touchdown por recepción
  • TGT:Pases dirigidos a los receptores
  • TOT:Tacleadas
  • TP:Total de puntos
  • TTD:Total de touchdowns
  • XP:Puntos extra pateados
  • XPA:Intentos de punto extra
  • XPM:Puntos extra convertidos
  • YDS:Yardas por pase
  • YDS/PA:Yardas por intento de pase
  • YDS/PR:Promedio de yardas por regreso de despeje
  • YDS/RA:Yardas por intento de acarreo