ESPN
    • Fútbol
    • F. Americano
    • Básquetbol
    • MLB
    • F1
    • Boxeo
    • NHL
    • Más Deportes
    • ESPN BET
      Watch
    • ESPN BET
      Juegos
    • Buscar
    James Carpenter

    JamesCarpenter

    • Tackle Defensivo
    • FDN
      31/5/2001
    • Universidad
      Indiana
    • Nacido en
      Roanoke, VA

    estadísticas de temporada regular 2025

    • SOLO
      --
    • CAPT.
      --
    • FF
      --
    • INT
      --
    • Perfil de Jugador
    • Noticias
    • Estadísticas
    • Bio
    • Splits
    • Resumen de Juegos

    Atajos Jaguars

    Estadisticas
    Calendario
    Profundidad por Posiciones

    Atajos NFL

    Resultados
    Posiciones
    Calendario

    Stats 2025

    Ver Todo
    Estadísticas
    Temporada Regular
    TOTSOLOASTCAPT.FFFRFRYDSINTYDSAVGINTTDLNGPDSTFSTFYDSKB
    ----------------
    Últimas noticias
    Ver Todo

    Racing Positions

      • Patriots afianzan liderato en el Este con un Henderson brillante
        • 4h
        • Mike Reiss | Rich Cimini
        henderson td celebracion nfl
        • Lions o Eagles, ¿quién saldrá fortalecido? Plan de Juego Semana 10
          • 5h
          • ESPN Digital
          nfl, 2025, receptor, amon ra st brown, lions, philadelphia, eagles, primera, siembra, playoffs, nfc,
          • Brock Purdy listo para ser titular en la Semana 11
            • 8h
            • Nick Wagoner
            brock purdy 49ers nfl
            • NFL quiere limitar apuestas en medio de escándalos en MLB y NBA
              • 9h
              • Doug Greenberg
              nfl apuestas proposiciones
              • Jets pierden a Garrett Wilson por lesión de rodilla
                • 10h
                • Rich Cimini
                jets garrett wilson nfl
                • NFL: Quiniela de ESPN para la Semana 11 de la temporada 2025
                  • 12h
                  • ESPN
                  NFL: Quiniela de ESPN para la Semana 11 de la temporada 2025
                  • NFL MVP 2025: Probabilidades de apuestas y favoritos
                    • 18h
                    • ESPN Digital
                    NFL MVP 2025: Probabilidades de apuestas y favoritos
                    • NFL 2025: Probabilidades y apuestas para playoffs, Super Bowl LX
                      • 20h
                      • ESPN Digital
                      NFL 2025: Probabilidades y apuestas para playoffs, Super Bowl LX
                      • Los Cowboys seguirán adelante pero no olvidan a Kneeland
                        • 1d
                        • Carlos A. Nava
                        Los Cowboys seguirán adelante pero no olvidan a Kneeland
                        • Mike McDaniel 'agradecido' con Dan Quinn en lucha por sobriedad
                          • 1d
                          • Marcel Louis-Jacques | ESPN
                          Mike McDaniel 'agradecido' con Dan Quinn en lucha por sobriedad

                        Find Tickets

                        VividSeats
                        Jaguars vs. ChargersEverBank Stadium - dom. 11/16/25, P.A.2,878 tickets as low as $52
                        Buy Jaguars tickets with VividSeats
                        Other Games

                        AFC Sur 2025

                        EquipoGPEPCTPAPC
                        Indianapolis820.800321206
                        Jacksonville540.556205220
                        Houston450.444204150
                        Tennessee180.111130257
                        ESPN
                        • Terms of Use
                        • Privacy Policy
                        • Your US State Privacy Rights
                        • Children's Online Privacy Policy
                        • Interest-Based Ads
                        • About Nielsen Measurement
                        • Do Not Sell or Share My Personal Information
                        • Contact Us
                        • Disney Ad Sales Site
                        • Work for ESPN
                        • Corrections
                        ESPN BET Sportsbook is owned and operated by PENN Entertainment, Inc. and its subsidiaries ('PENN'). ESPN BET is available in states where PENN is licensed to offer sports wagering. Must be 21+ to wager. If you or someone you know has a gambling problem and wants help, call 1-800-GAMBLER.
                        Copyright: © 2025 ESPN Enterprises, Inc. All rights reserved.