ESPN
    • Fútbol
    • F. Americano
    • Básquetbol
    • MLB
    • F1
    • Boxeo
    • NHL
    • Más Deportes
    • ESPN BET
      Watch
    • ESPN BET
      Juegos
    • Buscar
    Carolina Panthers
    Damarri Mathis

    DamarriMathis

    Carolina Panthers
    • Carolina Panthers
    • #28
    • Esquinero
    • Est/Pes
      1.8 m, 88 kg
    • FDN
      12/4/1999 (26)
    • Universidad
      Pitt
    • Info Draft
      2022: Rd 4, Sel. 115 (DEN)
    • Estatus
      Reserva lesionada

    estadísticas de temporada regular 2025

    • SOLO
      --
    • FF
      --
    • INT
      --
    • PD
      --
    • Perfil de Jugador
    • Noticias
    • Estadísticas
    • Bio
    • Splits
    • Resumen de Juegos

    Cambiar Jugador

    • Damarri Mathis
      Damarri Mathis
      #28
    • Tre'von Moehrig
      Tre'von Moehrig
      #7
    • Israel Mukuamu
      Israel Mukuamu
    • Lathan Ransom
      Lathan Ransom
      #22
    • Demani Richardson
      Demani Richardson
      #36
    • Nick Scott
      Nick Scott
      #21
    • Trevian Thomas
      Trevian Thomas
      #42
    • Akayleb Evans
      Akayleb Evans
      #29
    • Jaycee Horn
      Jaycee Horn
      #8
    • Mike Jackson
      Mike Jackson
      #2
    • Kalen King
      Kalen King
    • Chau Smith-Wade
      Chau Smith-Wade
      #26
    • Corey Thornton
      Corey Thornton
      #31
    Plantilla completa

    Atajos Panthers

    Estadisticas
    Calendario
    Profundidad por Posiciones

    Atajos NFL

    Resultados
    Posiciones
    Calendario

    Próximo juego

    Splits completos
    Carolina Panthers
    Panthers
    5-5
    16/11
    Atlanta Falcons
    Falcons
    3-6

    Stats 2025

    Ver Todo
    Estadísticas
    Temporada Regular
    Carrera
    TOTSOLOASTCAPT.FFFRFRYDSINTYDSAVGINTTDLNGPDSTFSTFYDSKB
    ----------------
    10381220000000.00090.530
    Últimas noticias
    Ver Todo

    Racing Positions

      • NFL MVP 2025: Probabilidades de apuestas y favoritos
        • 2h
        • ESPN Digital
        NFL MVP 2025: Probabilidades de apuestas y favoritos
        • Patriots afianzan liderato en el Este con un Henderson brillante
          • 11h
          • Mike Reiss | Rich Cimini
          henderson td celebracion nfl
          • Lions o Eagles, ¿quién saldrá fortalecido? Plan de Juego Semana 10
            • 11h
            • ESPN Digital
            nfl, 2025, receptor, amon ra st brown, lions, philadelphia, eagles, primera, siembra, playoffs, nfc,
            • Brock Purdy listo para ser titular en la Semana 11
              • 14h
              • Nick Wagoner
              brock purdy 49ers nfl
              • NFL quiere limitar apuestas en medio de escándalos en MLB y NBA
                • 15h
                • Doug Greenberg
                nfl apuestas proposiciones
                • Jets pierden a Garrett Wilson por lesión de rodilla
                  • 16h
                  • Rich Cimini
                  jets garrett wilson nfl
                  • NFL: Quiniela de ESPN para la Semana 11 de la temporada 2025
                    • 18h
                    • ESPN
                    NFL: Quiniela de ESPN para la Semana 11 de la temporada 2025
                    • NFL 2025: Probabilidades y apuestas para playoffs, Super Bowl LX
                      • 1d
                      • ESPN Digital
                      NFL 2025: Probabilidades y apuestas para playoffs, Super Bowl LX
                      • Los Cowboys seguirán adelante pero no olvidan a Kneeland
                        • 2d
                        • Carlos A. Nava
                        Los Cowboys seguirán adelante pero no olvidan a Kneeland
                        • Mike McDaniel 'agradecido' con Dan Quinn en lucha por sobriedad
                          • 2d
                          • Marcel Louis-Jacques | ESPN
                          Mike McDaniel 'agradecido' con Dan Quinn en lucha por sobriedad

                        Find Tickets

                        VividSeats
                        Panthers en FalconsMercedes-Benz Stadium - dom. 11/16/25, P.A.3,584 tickets as low as $43
                        Buy Panthers tickets with VividSeats
                        Other Games

                        NFC Sur 2025

                        EquipoGPEPCTPAPC
                        Tampa Bay630.667220206
                        Carolina550.500177222
                        Atlanta360.333168209
                        New Orleans280.200155250
                        ESPN
                        • Terms of Use
                        • Privacy Policy
                        • Your US State Privacy Rights
                        • Children's Online Privacy Policy
                        • Interest-Based Ads
                        • About Nielsen Measurement
                        • Do Not Sell or Share My Personal Information
                        • Contact Us
                        • Disney Ad Sales Site
                        • Work for ESPN
                        • Corrections
                        ESPN BET Sportsbook is owned and operated by PENN Entertainment, Inc. and its subsidiaries ('PENN'). ESPN BET is available in states where PENN is licensed to offer sports wagering. Must be 21+ to wager. If you or someone you know has a gambling problem and wants help, call 1-800-GAMBLER.
                        Copyright: © 2025 ESPN Enterprises, Inc. All rights reserved.